BT11395

Link to gene wiki page

[-] General Information


Transcripts for BT11395 BT11395-RA  

NCBI Gene Symbol: PLAC1

Description:
placenta-specific 1

Overlapping Locus Information:

NCBI: 767997
Ensembl: ENSBTAG00000006293

Genomic Location: ChrUn.53   463223 .. 463763    [-]

GO Annotations for BT11395

Biological Process
GO:0001890 IEA  placenta development
Cellular Component
GO:0005576 IEA  extracellular region

[-] Transcripts for BT11395

BT11395-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT11395-RA View Text HTML XML
Protein: BT11395-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001077057.1
NCBI Protein: NP_001070525.1
Ensembl Transcript: ENSBTAT00000008260
Ensembl Protein: ENSBTAP00000008260

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11395-RA
ATGAAAGTTTTCGAGCTGATAAGAGAGCTGATCATCCTCACCTCTGTGTT
TTCAGCCTGTTCCGGACAAAATCCAGTGACTGTACTGTGCTCCACAGACT
GGTTCATGGTCACGGTACACCCCTTCATGTTGAACAACGAAGTGTATGTC
CACTTCCATGAGTTATACTTGGGCCTGGGTTGCCCTGCCAACCATGTTCA
GCCACATGCCTACCAATTCACCTACCGTGTGACAGAATGTGGTATCAGGG
CCAAGGCTGTCTCTCAGGACATGGTTCTCTACAGCTCCGAGATATACTAC
ATTTCCAAGCATACCTCATCTAAGTATGTGATTCCAGTGTCATGTACTGC
CCCGCTATGTTCCCCATGGCTCACGACGTCCTGCTCCAGGAACTTAGCCC
CCAACGGAGGGGTCACAACCCGGAATGGCGAGACATGCTATGAAGTGTTC
ACCTTGTCACAGTCCAGCCAAAGGCCCAACTGCTATTGTCTGTCTTGTGT
CTACAATGAAAGAGGGCAGAGTCGAGCCCCACGTCAC



Protein Sequences

>BT11395-PA
MKVFELIRELIILTSVFSACSGQNPVTVLCSTDWFMVTVHPFMLNNEVYV
HFHELYLGLGCPANHVQPHAYQFTYRVTECGIRAKAVSQDMVLYSSEIYY
ISKHTSSKYVIPVSCTAPLCSPWLTTSCSRNLAPNGGVTTRNGETCYEVF
TLSQSSQRPNCYCLSCVYNERGQSRAPRH




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.